Supports automatic calculation and collection of local accommodation and hot spring taxes.
Also supports child rates.
Sell additional products through the electronic guest register.
Includes automatic monthly output of collection ledgers (optional).
Sell rooms with coupons on your own booking site (Beds24 function).
Also allows sales of beverages in the guest room refrigerator.
The possibilities are endless.
The guest register becomes a means of generating additional sales.
A separate credit card processing fee of 3.6% (Stripe Japan) applies.
No more waiting in long check-in lines. Early check-in, parking, laundry orders, shuttle requests, and payment collection can all be handled with just your smartphone.
You can also create guides to recommend nearby spots and issue coupons.
A link to the guest register is sent at the time of booking. Guests can fill out the guest register at any time before their arrival.
We've integrated small-amount payments, which previously relied on ticket machines or manual transactions, into our check-in app.
Electronic guest registers are entering the era of sales promotion – moving to the next stage.
A simple design that doesn't detract from the atmosphere of the accommodation.
Uploading your ID is also easy.
Debugged and stable operation
Excellent stability thanks to coding from scratch.
Easy to configure settings for multiple accommodations; also supports accommodation taxes from different municipalities.
It is used by guests who have confirmed their arrival, through integration with the PMS (Property Management System). The data organized in the guest register is also convenient for generating reports.
We make digital transformation more easier to everyone
Please check the usability of the guest register with the sample.
Below is an actual sample guest register. The front is the guest register, and the back is the account book for each guest.
*Because this is a white-label (optional) application, the domain is app.travelerswharfshichigahama@com.
Normally, it is app.quickguestbook.jp.
*As a sample, the Miyagi Prefecture accommodation tax is applied.
*The accommodation tax to be applied can be selected (switched) from the management screen.
*Reservations are received from beds24, and the accommodation tax is automatically calculated and displayed in the account section of the guest register.
*Additional product sales and accommodation tax collection are also processed by credit card (a separate Stripe processing fee of 3.6% applies).
*A collection ledger is also automatically created (optional).
